SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028161|ref|YP_001013481.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028161|ref|YP_001013481.1|
Domain Number 1 Region: 87-186
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.66e-24
Family Ribosomal protein S3 C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.96e-22
Family Prokaryotic type KH domain (KH-domain type II) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124028161|ref|YP_001013481.1|
Sequence length 247
Comment 30S ribosomal protein S3P [Hyperthermus butylicus DSM 5456]
Sequence
MVLIKRYFIKKAMVQTQIDEYLAKRFYRAGYAGVQIIQFPLGTRVIIYAERPAMIIGRRG
ETIRQLAAIFEHEFGLSNPQITVRRVENPDLNARVVASRIAVLLERGAYYRRVANVMARR
VLNAGAIGVQIVISGKLRTERARYEKVRRGKVYTTGHQVEYMVDRAVMHVTLKPGVLGIE
VMIVKPAKPSDYVRIKQPEEVKEFIEQVRSELEKARAAEAAAAVAQQGEVVGEAPNTPLE
EQGQKQG
Download sequence
Identical sequences A2BMC5
WP_011822454.1.50451 gi|124028161|ref|YP_001013481.1| 415426.Hbut_1306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]