SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028309|ref|YP_001013629.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028309|ref|YP_001013629.1|
Domain Number 1 Region: 8-220
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.88e-58
Family FAD-linked oxidases, N-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 225-474
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 8.67e-55
Family D-lactate dehydrogenase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028309|ref|YP_001013629.1|
Sequence length 474
Comment dehydrogenase [Hyperthermus butylicus DSM 5456]
Sequence
MGVHRVTGIVQELESILGRGKVYDDPAVVALYSREPSGLEGFGLAVVFPETAEDVSRLAA
WAYRRMVPLYPQGSTTSLSGSAVPENGVIVSFERMNRILEVSVLDSVAVVEPGVRIAELN
LELARYQHMFPVDPASQAVATVGGAINSGAGGMKGAKYGTMRDWVNQLEIVLADENGTRM
TIGCRTVKCRQGYDLVRLIVGSEGTLALVTRAVLRITPLPEAAPTVLGFFDNLGDLVDAF
LELRSAGVQPLLAEFLDARTVSIARRGLPGFENVEGHMLLVSVEANREAVERIQAQLVKV
FESHGAHGIRVAGDLGEAEEKGLLALRRRLLPAQLEYSRRYWGAPRVQVFIEDIVVPPSR
LVEAVEMLNQLTEDYGLPMVLGGHIGDGNLHPAVGFDPGDPGAASRVHAWFTEVMKLAVK
LGGSVSAEHGVGMLKREGLRIELERLGSLKALELMKAIKRLFDPHNVLNPGKLF
Download sequence
Identical sequences A2BMS3
415426.Hbut_1460 WP_011822602.1.50451 gi|124028309|ref|YP_001013629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]