SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028378|ref|YP_001013698.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028378|ref|YP_001013698.1|
Domain Number 1 Region: 10-131,247-401
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.35e-89
Family Substrate-binding domain of HMG-CoA reductase 0.00000314
Further Details:      
 
Domain Number 2 Region: 134-249
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 4.71e-44
Family NAD-binding domain of HMG-CoA reductase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028378|ref|YP_001013698.1|
Sequence length 428
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hyperthermus butylicus DSM 5456]
Sequence
MQESERSKLEEVVRGIIEGRIKLHEADKILGNANAGALARRLALEKMLGVSLSSIGSTIL
DFEELVGRNIENPIGAVQIPVGIVGPLRVRGDYANGDYYVPMATTEGALVASVNRGAKAI
TLSGGARAKVLRDGMARAPVFWTPGIEEAARFVEWVREHMDEVRREAESTTRHGKLLEVQ
PFITGNLVWLRFVYETGDAMGMNMATIATDKAAEWILANYPGTVRLIALSGNMCTDKKPA
LLNMLFGRGKTVVAEAVIKRDVALKVLKARPEEIDFVNRVKNLLGTARAGSFSLNAHFAN
IIAAIFIATGQDVAQVVESSMGYTWTEVRNGDLYISVTLPSLEVGTVGGGTRLPTQREAL
ALMGVAGGGDPPGSNARKFAEIVAATVLAGELNLLAALAANELARAHKLLGRGEARKEKN
TANSKPTN
Download sequence
Identical sequences A2BMZ2
gi|124028378|ref|YP_001013698.1| WP_011822671.1.50451 415426.Hbut_1531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]