SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124028441|ref|YP_001013761.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028441|ref|YP_001013761.1|
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.57e-19
Family Ribosomal protein L39e 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028441|ref|YP_001013761.1|
Sequence length 51
Comment 50S ribosomal protein L39e [Hyperthermus butylicus DSM 5456]
Sequence
MAHFKPLGKKLRLAKALKQNRSVPIWVIIKTNRRFRDHPKRRHWRRTKLKA
Download sequence
Identical sequences A2BN55
415426.Hbut_1597 gi|124028441|ref|YP_001013761.1| WP_011822734.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]