SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028442|ref|YP_001013762.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028442|ref|YP_001013762.1|
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 5.89e-23
Family Ribosomal protein L31e 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124028442|ref|YP_001013762.1|
Sequence length 100
Comment 50S ribosomal protein L31e [Hyperthermus butylicus DSM 5456]
Sequence
MPKDKKEAIYTIPLSRVYWGRRTNRAARAIKLVRKFIARHFGVKEEDVIIHNNVNEYIWS
RSIEKPPRRVTVKAVKDPETGKVKVMLIRESKIQQGQATS
Download sequence
Identical sequences A2BN56
gi|124028442|ref|YP_001013762.1| 415426.Hbut_1598 WP_011822735.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]