SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124027050|ref|YP_001012370.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027050|ref|YP_001012370.1|
Domain Number 1 Region: 166-436
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.88e-72
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000966
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.65e-47
Family Malic enzyme N-domain 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027050|ref|YP_001012370.1|
Sequence length 465
Comment malic enzyme [Hyperthermus butylicus DSM 5456]
Sequence
MSEKERIDWYSISKKLHRLYEGKIEVIPKVPAFRQDDFAIWYTPGVAGPAKEDAEDPDAT
FHNTWRWNTVAVVSDGTRVLGLGAIGPEGALPVMEGKALLFKALGGVDAVPLVHRARDRE
KFLELLVLIEPSFGGINLEDIESPKCFYLLDEARKRLNIPIWHDDQQGTATVTLAGLINA
AKLTGRDLRKMRIALIGAGAANTALYRLLKAYGVDPKNMVVVDSKGVLHSQREDIEKLKE
KNPWKYQIAVETDGGWNQLRGGGIKEALEGAEAVVAASKPGPGVIKPEWIKLMDKDPIVF
AEANPVPEIWPWEAKEAGARVVATGRSDFPNQVNNSLAFPSIFRGVLDVRARTITDTMAI
AAAEELARFAEEKGLREDYIIPSMEEWEVYPRVAAATAVRAVEEGVARLKTTYEEEYEKA
KQIIATSREKVLKLVDVGLIKKLPEEVEAVIQRARRQREEMLKAR
Download sequence
Identical sequences A2BJ64
415426.Hbut_0153 WP_011821342.1.50451 gi|124027050|ref|YP_001012370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]