SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110802991|ref|YP_698411.1| from Clostridium perfringens SM101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110802991|ref|YP_698411.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily YjgF-like 8.64e-48
Family YjgF/L-PSP 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110802991|ref|YP_698411.1|
Sequence length 126
Comment putative endoribonuclease L-PSP [Clostridium perfringens SM101]
Sequence
MAKEIIKTNKAPGAIGPYSQGIKIGDFVYTSGQIPLNPETGVMAGSIEEQTAQSLENIKA
ILEAAGTSMDKVIKTTVFLSDMNDFVRMNEVYATYFTENQPARSAVEVAKLPKDAKIEIE
VIATLK
Download sequence
Identical sequences B1BU96 Q0STZ6
WP_003464131.1.90682 289380.CPR_1089 gi|110802991|ref|YP_698411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]