SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118617157|ref|YP_905489.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118617157|ref|YP_905489.1|
Domain Number 1 Region: 84-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000837
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118617157|ref|YP_905489.1|
Sequence length 144
Comment hypothetical protein MUL_1496 [Mycobacterium ulcerans Agy99]
Sequence
MPVALIWLIAALVLAGAEALTGDIFLLMLSGGALAASGIRWLTDWPLWADGAVFLIVSVL
LLALVRPALRRKLAPAKALQLGIKALEGKNALVLDRVARDNGQLKIEGEVWTARPLNDGD
VFEPGDSVTVVHIEGATAVVFRDV
Download sequence
Identical sequences A0PNU9
362242.MUL_1496 gi|118617157|ref|YP_905489.1| WP_011739638.1.20315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]