SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118617364|ref|YP_905696.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118617364|ref|YP_905696.1|
Domain Number 1 Region: 119-311,398-559
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.11e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000441
Further Details:      
 
Domain Number 2 Region: 289-411
Classification Level Classification E-value
Superfamily GAD domain-like 1.2e-32
Family GAD domain 0.00038
Further Details:      
 
Domain Number 3 Region: 5-106
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.9e-29
Family Anticodon-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118617364|ref|YP_905696.1|
Sequence length 593
Comment aspartyl-tRNA synthetase [Mycobacterium ulcerans Agy99]
Sequence
MFVLRSHAAGALRDSDAGRQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFREADVLAQ
AHRLRAEFCVAVTGVVEIRPEGNANPEIATGEIEVNASSLTVLGECAPLPFQLDEPAGEE
LRLKYRYLDLRRDGPASAIRLRSKVNAAARAVLAGHDFVEIETPTITRSTPEGARDFLVP
ARLHPGMFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMELSFV
DVEDIIAVSEEILTALWALIGYRIPTPTPRISYADAMRRFGSDKPDLRFGLELVECAEFF
KDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGHRGLAYVLVGEDGTLGGPVA
KNLTDAERDGLAAHVGASPGDCIFFSAGPVRASRALLGAARIEIAERLNLIDPSAWEFVW
VVDPPLFEPAEDATASGDVAVGSGAWTAVHHAFTAPKPELEDRIESDPGSVLADAYDIVC
NGHEIGGGSIRIHRRDIQERVFAVMGLSKAEAEEKFGFLLEALTFGAPPHGGIAFGWDRV
STLLAGADSIRDVIAFPKTGGGVDPLTEAPAPITAQQRKEAGIDAKPKQVEGT
Download sequence
Identical sequences A0PPF6
MyulA.00145.a gi|118617364|ref|YP_905696.1| 362242.MUL_1743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]