SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118618621|ref|YP_906953.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118618621|ref|YP_906953.1|
Domain Number 1 Region: 9-303
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.16e-75
Family Heme-dependent catalases 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118618621|ref|YP_906953.1|
Sequence length 315
Comment catalase [Mycobacterium ulcerans Agy99]
Sequence
MGGSVTPDEAIEAIRGTGGACPGYRALHAKGTLYRGTFTATPEAAGLSRAKHFDGATVAA
LIRFSNGSGKPTQRDGAPGVRGMAVKFTLPDKSTTDVSMQTARLFTSSTPEGFVDVLKAL
RPSLTTPARIAKYLVTHPRVLAALPILGAANRIPASYATCEYHGLHAFRWVAADGSARFV
RYHMIPAVGEKFLSPLAARNQGGDFLTDELQTRLAAGPVRFYFRVQIAGPGDSIVDPSVP
WQGSEMVTVGTLDVTGVDTEREHDGDIVVFDPMRVTDGIEASDDPVLRFRTLAYSASVKL
RTGVDRGPQAPPDPA
Download sequence
Identical sequences A0PT13
362242.MUL_3283 WP_011741091.1.20315 gi|118618621|ref|YP_906953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]