SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118619784|ref|YP_908116.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118619784|ref|YP_908116.1|
Domain Number 1 Region: 14-210
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-55
Family Formyltransferase 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118619784|ref|YP_908116.1|
Sequence length 215
Comment phosphoribosylglycinamide formyltransferase [Mycobacterium ulcerans Agy99]
Sequence
MQEPVRVPPSAPARLVVLASGTGSLLNSLLDAAVADYPARIVAVGVDRDCRATEVAAQAS
VPAFTVRVSDHPSRDAWNAAITAATAAHSPDLVVSAGFMRILGPQFLSKFHQRILNTHPA
LLPAFPGAHGVADALAYGVKVTGCTVHLVDAGMDTGPILAQQAIAVLDGDDEATLHERIK
VVERKLLVDVVAGIAAGGVTVIGRKAMIGRKATIG
Download sequence
Identical sequences A0PWC6
gi|118619784|ref|YP_908116.1| WP_011742240.1.20315 362242.MUL_4713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]