SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000014943 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000014943
Domain Number 1 Region: 236-469
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000292
Family Clathrin heavy-chain linker domain 0.096
Further Details:      
 
Weak hits

Sequence:  EPrPV00000014943
Domain Number - Region: 877-931
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00589
Family DRTGG domain 0.033
Further Details:      
 
Domain Number - Region: 877-1036
Classification Level Classification E-value
Superfamily ARM repeat 0.0134
Family Armadillo repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000014943
Sequence length 1202
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_61:37109:40935:-1 gene:maker-pve_contig_61-snap-gene-0.41 transcript:EPrPVT00000014943 description:"Serine/threonine protein kinase."
Sequence
MPKQELFDSLAPTVSRTPQPPVFTSPAPDVIKASLPSAREFEVNSSTNDTALARSEDTFE
MDFDTPKHVEERKDRLTTENEKRPVSAPAHNNGIMTGKTRINETTADLKTAPGKRDIENV
DKIPTTSNSSNDRDRSPPTIRKAPATAPPKPSNGGAPTRRLLLETAFDRDGKMGSGLRKA
SKLLFTAGDCCVKPIVCSDDIEDIVLPRVQLESLPFPPVSPEQLLSCDTEVLEKHLKDIY
VTLKRVDLDWREQLMVLSHLFSCCHHAKLANVIVNSSILSLLTKKLHLGTSDASPLHDSS
KSVVAMTCLILGVLFRFATFFAPSSTDQVHSLVETLADIGVSQNDDVSHHTLDPRRQAVA
CLGELLFYMSTQREREVPMVGWDRISATLDNDDLVLRHYAARTLCNTLTNCQEGLIPTLI
SEQHVSTLLRNIMEYSEVASDPSRLQLVIGVWVTTTQFLAQVFRYLRSPSMKKILPSKQR
SSLLMLCAKRNAIRGLWKGFQTGVASEVADLAISSLNVLNAFVEIKLDGCRDSDRETIEL
SREDLLERVITFTEFSTVLGKRANIMDASRGSRLKSELNVDGKLDEDETSLLRAKLILLL
YLGVQSNRSFIARCLQAQVFRQVESCFAPLVAIVESELLESNSISDTSSFQSKPSPSSSA
STATTSLQRTMDSMSPANTYLLQCQLNLIKMSVRTALKIAAECISSTERSGDSLSKQVTI
TAVPFQLLEALLNNHACRVQLLEYFVANENKQYTFFLRLMAKMLAIFPDHSLESISDGIS
VGVYLSKILLLLFQCAADEASDIVLVEQESLYLSLLPALADQITRDSTSSTRSQADSAEL
SVASIRVIYLVLLQFELDPVSVDTEQQHRAQFIRGCLLPRLCVLLTGEHHVNENVWRFAI
ELLFGLISSDISLLTTGDNTDDVADMIIQLLATPRQHGYHSLPSSATKLVKMLTGNASVK
VDKLYELNIVDRLLSGLSFAAGEALGGCVMDLLEVLLELLHHRYEALRQHDRAAQNHPPN
FEKWLQCASLMVQLCGVREPTPSPSRAKSEAADERQSGLDTAAGEHGAVIADVASRCLIF
LSQLFGEKLNDVLFRKGRSSDAKNVVARSAASTSAIVLRVLLTLKNCLRCQGNNSTVVSC
WFSENPKVCQAIKQLTPPKGGRDDDKGDKRNSAATARVREQITKTATDILRLSDAFSPPR
SV
Download sequence
Identical sequences EPrPV00000014943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]