SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000017271 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000017271
Domain Number 1 Region: 382-703
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 2.3e-84
Family Phosphotransacetylase 0.000000794
Further Details:      
 
Domain Number 2 Region: 8-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000129
Family Nitrogenase iron protein-like 0.046
Further Details:      
 
Domain Number 3 Region: 208-336
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.000000000000184
Family DRTGG domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000017271
Sequence length 720
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_202:30969:33131:1 gene:maker-pve_contig_202-snap-gene-0.16 transcript:EPrPVT00000017271 description:"Phosphate acetyltransferase."
Sequence
MTRRTSPVLLGLANTLEQKFKSVGYFRPIQPEGPNADHHVELLHQQLELSDKEPRQLYGV
TASRAVDAWLSGKEDDLVEEILSAYEKAKVGHDFMIIEGSQVSDHESSMSWRINADIAKS
LNAPVLLVNDFAETHAKGAEVVDEILRRARLAKDEAEDAGLNFFGTIANRVQSSDPVALR
RAVRAKAAEANLPILGFLPNDRFVASNRLNEVAYQMGATQLFGNRDIPNNAIVSNAVVAT
SALKDLFDHLKKYKDGVMIITSADRSDLILGLMVSRLPGVLPNISAIMLTNGNYPHSNTR
EILQGVESLDKFGLSIPIFSVPMDTFDTASGFRRVSTDILPTSQRKIERCHQLFDEFVEK
EMLIGELDQGVVVHRSPKHFKHFVLNKARAVKQHIVLTEGEDIRVLQAADEAIRENLATI
TILGNPDEIALNAKQFNLDLSQANIIKTADSPWVKKYADHLYEKRKHKGMTREMANDQVL
DETYFGTLMVELGDADGMVSGACHTTANTVRPALQLIKTDPSRPLVSSVFFMCLESGVRL
YGDCAVNTDPTPKELAQVAVQSAESAEAFGMIPKVALLSYATGDSNSGPIIDKVREATAI
AQSMRPDLDIYGPIQYDAAVDMSIAASKLKKIPSGAKVGGQANVLVFPDLNTGNNTYKAV
QQSTGCIAMGPMLQGLRKPVNDLSRGATVKDIVTTIAITAIQSDQVARKKSGAGQASGEQ
Download sequence
Identical sequences EPrPV00000017271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]