SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000017901 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000017901
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily DOPA-like 7.59e-21
Family DOPA dioxygenase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000017901
Sequence length 127
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_252:3689:4376:1 gene:maker-pve_contig_252-snap-gene-0.9 transcript:EPrPVT00000017901 description:"DOPA 4,5-dioxygenase."
Sequence
MGAESVPAQAARPAAGPIKEWHFHTYWFATRNPKSGEEAQALHDALVEKVASDPEFIAVC
NGVTSAQLPGLSFAKVLSWFTLHRGSLTVLVHPLTRYELEDHTTHAMWLGSGEASSFGSI
LELNASV
Download sequence
Identical sequences EPrPV00000017901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]