SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000023638 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000023638
Domain Number 1 Region: 7-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.58e-25
Family Nitrogenase iron protein-like 0.027
Further Details:      
 
Weak hits

Sequence:  EPrPV00000023638
Domain Number - Region: 276-361
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0011
Family HPr kinase/phoshatase HprK N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000023638
Sequence length 389
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_1351:2763:4118:-1 gene:maker-pve_contig_1351-fgenesh-gene-0.0 transcript:EPrPVT00000023638 description:"Cobyrinic acid a,c-diamide synthase family protein."
Sequence
MGRKPAAVYVAATRQHVGKTSTCVGLLQGLTDRIEHIGFLKPVGQESVPVGNTGVRVDKD
VAVAKEVFRLNNCQYADMSPVVIPPGYTRKYLDGQITFESQLAKIQRSFARITAANDVSD
RCLAPQLVYTIVEGTGHTGVGSIVELNNARVAAELGVDMVLVANGGIGSAFDDLALNHSV
CRDYGVKIRGVILNKVRYDKMDMVKEYFPKALRQWGVPLIGVVPNLPSLANNSMLDFEGL
FKTRMLSGHARRFQQYSRTCLVTSGLRRFLAKLASNEFNDALFVTHATRNDIILGFLSHL
QTFEAKTGTRFGGGMILTGQPPHDQPQEYIMGTIRYTDAPVLYAPVTTFDAMERITRFTA
KFNPTDRDKVVACGKHYAQYLDFDIILDR
Download sequence
Identical sequences EPrPV00000023638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]