SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000015687 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000015687
Domain Number 1 Region: 1846-2142
Classification Level Classification E-value
Superfamily BEACH domain 7.46e-118
Family BEACH domain 0.0000000249
Further Details:      
 
Domain Number 2 Region: 2382-2636
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.88e-16
Family WD40-repeat 0.0069
Further Details:      
 
Domain Number 3 Region: 1722-1839
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000264
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 86-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000528
Family Laminin G-like module 0.08
Further Details:      
 
Weak hits

Sequence:  EPrPV00000015687
Domain Number - Region: 457-498,546-585,744-835
Classification Level Classification E-value
Superfamily ARM repeat 0.00461
Family Armadillo repeat 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000015687
Sequence length 2644
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_97:38194:46128:-1 gene:maker-pve_contig_97-snap-gene-0.22 transcript:EPrPVT00000015687 description:"Neurobeachin."
Sequence
MDDEASAPTRQLRELARQSLRAGSADLPSSARAQLLKDVQSTTHLVAARLLVSPELLERE
EDKSTLQELLPRAVVAPPTSFFELRDSGRLHLPIIDWGGFRGYSVALWLKVSGLDATTKV
DSADPAKFTLFRFANNSSTLGVEATLEPSDLDSGVMMLTVSSCAPAAAEQRRFQSAAAIL
SSGAPEWKRVQHPIRVSSGEWHLLVISHSLHYVKKSKVSCFVDAQLHFRDELVYPSGLVT
ASKCTIGGGHGAHVQIASASMYKEELSPELVAMLFRLGPSVSAFNRWGALPLPATTSQLT
GGFFESSIAPSPIAIPPTRGPFSELCKAEVVFAFTAENVVNEDYDDLGVEWLAEGSLSGK
SGKWLTLESTMGVSAEIQQRNARLSKLVHKRLFPDYRASWFRALGIPSVAMLLDSVLTAF
DKLRAEEQGSEVVSVVENIVVDLTWIIKGLLLNNPINQQAVLQTYAFHMLAHVLTSHEQC
LSAIWTPGSLVAVVEMVQSLFGMLPLARTGEHLSLDHPFQVSVWNTNPLVASAIRTLLLD
FRLWTRCDFKTQSIFNHQLYGLACEHPQVFNDLHAVDKLLEILATFYASSGSLNATTATT
AGVNGESQNSRQLTEQADKEHHWQQQCVQTLVEIIEVCLTNQSVHVHEVLEDELLETTYA
RSSSTANTNATQAGNASSGGGATTASTLSTATRRGGVLSINLENIVWSDQSAATATSNSA
EGDETAKPAKPSTPASTLTHVQIRFSLLRDLRSIVRFLLTSQDATICASLLLLLRRLSVS
FLDMRFGLVSSSIVDCLLFLMQPPQPTDTGGNALVDASASIRVRMACVPVLIYLLDWLES
IEGRTVWCGIEEHLRFMLNGDGNFSSGFLELMMEFYFDPVWLLGVQHSIVMNDPTKKDSV
LFPIATSAEKVTASIHDSGIVLSDSGLAAAASGGGASGNGDASGIVDWIKMASQFVGKRL
SLAWEKRIAVIRMTALRSLSANTATSNESKHVTPVADMFDEGVSGILSLPLRGVLSFLPI
LLGRSSAHFREKVLMDINVKLKTDEALQDGLLLLKRNWADALLELSLVCSVHDVDAGATA
ANTEANSEPTTAGGEPTECGRAYGVDANKTGEDLVLDTIVSLLCRSMHSARGWRAMTHVI
LALKGLQQKYDSSVDGASAAVSSIPPAVTTSQAMKSELLSQPLQWLCRATGIVIQRMARS
RTILSRVLAENVQRLMFLSYETLLAAPLPTVTDEQHQQSDTFRSRSPARWSEAQVFLLNA
VLDMNVRLIESTHHLHRVGLFPGLQILQRALPFVNSTALMERVVEALVLSFQQEMGPVAA
LKVYESVPTRDVFLSALVCLRRALVVHDQEPLLALLRSLTLRIVTSGAFTDELVAVGVTV
PALSTLSEAEAVSVVLDALALPVNETELHDREEAGDMVPYFPSAQELRLLTMSKPDEQSA
GSTSSSAGRVSRSRSLDLLDESDRVLWAALEVEANRMMESLRKTRGRERARASAQRDVLD
PRQRSWTTTQWRKNEFTFRSEHEPPRAPLDVGEPSVWRIGSFESAFPARMRRALDVDFVR
TADLRARKVGRVLARTTSSDKARTANKTRRQPSLTLELIQGLDDIVTNSPLSSPVAKASG
QLLERVGRVVAAQGGGEIRDITADEALTQVNDEIDKIIDEFEEDKDVSPESKAEVEATER
ASMVQVSAVADGDETQQAVHISEEAAGFDPGTGAGVSADDHVFTRVECRRVVAEGIVLGQ
LFFCNKHLVFVPQQDADLNDTSDDKKSAAAAKPSVASDEAAPGLHRCWRWKYGHVVGVYL
RRYRLRDSAFELFLRNGSSHFLDLPAAPKTRRDELVRLLYSFLPRHIPKQWPGRAMPNLA
ATTKAWQHRQLSNFDYLMALNTFAGRSFNDLTQYPVFPWVLTNYDGDHLDLSDPSNFRDL
TKPVGALNAARLQEYWDRYNSFDDPVIPKFLYGSHYSTCAGVVLFFLFRLEPFAALHQKM
QGGAFDLPDRLFLSLRETWRMCNSQMSEVKELTPEFFCDPSFLRNLNGYELGTRHDGQVV
GDVQLPPWANGSPEEFVRLHRAALESELVSQHLHEWIDLIFGAKQRGRAALAANNVFYYL
TYYGVVDLDQIDDPFLRESMELQIAHFGQCPLQLFSSAHPKRNPRAFSRKLPGLSTPSFA
PSTSNSVSSPTTTVSSPVVSSPGGSGGGGNTGSSGPVSTIPKPLSLAFQDATAAAQERRK
LWSPVVTVKPIASSRIRLLKILPDRVVSVNELGVVELFHWKLLPRPQPTNDVSDDGTALT
PPSGDRWANGFASSASFEEDNERLSTSSIGDRLSEDTVLAGLASPSKEAVSAPTCPWLIE
VARDDSPFDYVPRVPVFEHHDPSVTTDSKVKPSARRSRGFPIAITSNGRVVVSGGARNGA
IHFRLVDLDNGHVVGKASVVGHAAAVTCLSMDKWSYATPVAQHDDDQLLVSGAKDGTLAL
WRLSRVKPDLLFRLPRVSPRPILVLRGHTDAVRDCCVSSYLGLVLSCTYTTALAHFLYQD
GRVAFAFEPAASSAAADRHRSEFSHVRISAKGLMLVVTRVLRIAGDGDEAAGTSKSKQEA
GVVVASICQVYNLMGVCVGSHTFDDEDVTDLQLSAEGDLIIFTLFPGTIRICRTDEYVLS
ECCE
Download sequence
Identical sequences EPrPV00000015687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]