SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000018084 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000018084
Domain Number 1 Region: 284-405
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.75e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.000042
Further Details:      
 
Domain Number 2 Region: 397-445
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000791
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000018084
Sequence length 647
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_267:21346:23462:1 gene:maker-pve_contig_267-fgenesh-gene-0.3 transcript:EPrPVT00000018084 description:"Branchpoint-bridging protein."
Sequence
MASDAGGGGFAAFMDFVDKKETTEERDEAPPVDEYHYEEAQEREAMMKSYHHPMKQWFRE
NPRLADKYGAYPLFWQELKTWTPYREVLKEFIKHTEGGRSGETTEAEDGNTSGDKATAAA
VHDTKKEEVKPAAADAQAASTDESQPRKRRKSRWGDPVDEAPAAAGDGEKRRKKSRWAPA
GAPGGGVVNLLAQKQQQSVALRAKLDAINQRITTVAVDAARIEKDPSRSPSPPPQYDANG
KRTNTREVRMRAALEKSRQETIEQLVKINPLFRPPSDYQRQRLHRKIYIPVHDFPNYNFI
GLIIGPRGNTQKRMEKETGCKIAIRGKGSVKEGSKGKKMNSDENDDLHVLITGDREDDID
RAAKEVQSLLVPVDDTKNSHKQKQLRELALINGTLRDDDFCHLCGEKGHRQWECPNRDQS
FKSANVKCAICGDSSHPTRDCTQKRKSAAENAAIDKEYQSFMQQLGENPVISSASAGSAA
PAAPVAPWLQPAKTSSSASSQPWLTKSAGAPGTASAGAPGTAPVMAAPGTQAPAGQAAIG
ATPETAYPPPAGAYGGYAAQGWGAQAGQQEWGAAQQQDWNAAGYGAYYGGWDGSSVAGAP
GAEYQQYSHYGPPAGASGATNASGYAAPGSSDAQYQYSQYGNGANQQ
Download sequence
Identical sequences EPrPV00000018084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]