SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPV00000019319 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000019319
Domain Number 1 Region: 281-322
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000171
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000019319
Sequence length 340
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_389:9501:10594:1 gene:maker-pve_contig_389-fgenesh-gene-0.2 transcript:EPrPVT00000019319 description:"Conserved hypothetical protein."
Sequence
MEVAVRDDPQATLRAWTRQPCPSCKRSYKFFCPICFVPLGAPEGVTVPSLALPVQIHVWF
QDKIKKSTAPHAKVLAPEDVQIIPFPIAEDSSIPSTYTFENTVVVYPSPEAETLDKLPRE
TLEGIQNMVFIDSPWQKAPVILQDPALAGLRCVKLATPPHHSKFWRYHQAGAGCVSTIEA
IQLMLSEFIAAMKAAGAVLPPRADKVEPADLLFYFNLVHTCIADTYENDPNQKRKPPMDE
GEKERQRILRNQKDAGKRRRIENKREAWEQISRALETGEIQELPRSGKCYNCKKHGHEAK
DCTAPCRYCKQAGHYSGVCTMRGDRQDQAQQQAQSRTKAL
Download sequence
Identical sequences EPrPV00000019319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]