SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113460286|ref|YP_718345.1| from Haemophilus somnus 129PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113460286|ref|YP_718345.1|
Domain Number 1 Region: 6-75
Classification Level Classification E-value
Superfamily YehU-like 1.83e-24
Family YehU-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113460286|ref|YP_718345.1|
Sequence length 79
Comment hypothetical protein HS_0140 [Haemophilus somnus 129PT]
Sequence
MEQFAMLIPWEKLEEQTLLNIVDSFILREGTDYGSTELSLAEKRENLFKNIRQGKAILVW
SELHQSIDIKNKMDFLNRK
Download sequence
Identical sequences Q0I0Y3
gi|113460286|ref|YP_718345.1| 205914.HS_0140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]