SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113460691|ref|YP_718757.1| from Haemophilus somnus 129PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113460691|ref|YP_718757.1|
Domain Number 1 Region: 27-120
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000248
Family Apolipoprotein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113460691|ref|YP_718757.1|
Sequence length 184
Comment Sec-independent protein translocase TatB [Haemophilus somnus 129PT]
Sequence
MFDIGFSELVLLFVVGLIVLGPQRLPVAVRTVMGWVRTVRSLATNVQNELSQELKLKELQ
ESIKKAEDLNISQLSPELSETVEELRQSAQKIKMNLEEKAAETNSSVEEQVQELKSAVQN
SQGTATTEIEKNFDFPSGELSPAELAELAEEGEPMLEMGESDFSEDEQATASSNETIENI
KEKV
Download sequence
Identical sequences Q0I206
WP_011608703.1.80932 gi|113460691|ref|YP_718757.1| 205914.HS_0546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]