SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113461393|ref|YP_719462.1| from Haemophilus somnus 129PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113461393|ref|YP_719462.1|
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily MtlR-like 1.26e-53
Family MtlR-like 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113461393|ref|YP_719462.1|
Sequence length 171
Comment mannitol repressor protein [Haemophilus somnus 129PT]
Sequence
MLSEDPIYEKLNGTVSVRGFMIAIVAIFEEAVDSLINRVFRKTDFVVQSVIDSLFTNDGP
LGDLSVRLKVLLGLGVIQHNLFSDVNAFIQFKETLNKDEKEYTFDDEIVLTFLQKLTLLM
DKSALDFEPLIEDKNSLTYQMKSLRREKIIRSCLILTIADIYRQLQIESPF
Download sequence
Identical sequences Q0I4Y3
205914.HS_1250 gi|113461393|ref|YP_719462.1| WP_011609404.1.80932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]