SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114321519|ref|YP_743202.1| from Alkalilimnicola ehrlichii MLHE-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114321519|ref|YP_743202.1|
Domain Number 1 Region: 605-734
Classification Level Classification E-value
Superfamily PKD domain 0.0000144
Family PKD domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114321519|ref|YP_743202.1|
Sequence length 867
Comment hypothetical protein Mlg_2372 [Alkalilimnicola ehrlichii MLHE-1]
Sequence
MYRLSRFIQLLIILLVLVLMAGCVEDEDFGGGLGGEPERIEIVSDQSIILSGAGDSAEIE
AYVVLDNGRVDRTATIEYESTNPDLIGVDASGRITALTHTIGSANIQLSAEGVEPVMALA
AIADLAPGALYVDAGWVVDDRLTDEDELTARVVLQRNEQTEGLAPGDVLVSGDRAGLLDR
VTEVTVHGNRVVLETEPAELTDAFENLSIQAQGTPLNYGGVLDEDGHDDGRPEGAGVSGA
AAEDRVSGAAVQQIQGGLECKLGGSVLNIGVTGLSINHNYALVPRVDLDISNRSLNRFDI
YLDGQGHLNASLGGVTLSGGGSADVNCSRGLRSVPFAAVPVVGPVLLTPSLEPSVGFKVA
GSYQAGELSLSGIELDQGASMELGIGYTGVQGFRGINEFETFGDGVDFANLGGGLENEFS
ASVGPYMGAALNLDVRVLRWELASTGLVGLEIGGGSDLSMTYPFDSEEQDYRGPRWSFFA
EGKAGFGPLLDSIKAFERILDRMGVPGAANISGFVSTNVNLVDIHRSLLQSPNPQVQAAP
AKVEVEEPLSLQVSAGQSIGSLDTDFVAFRTDQANDAPWTREVVAQASNDGNGNATETWV
PATEEAGVYAMNVRVYDGLFGALGFPYAAENPANVEVSSDVILRIDPPGLSDGEVGVQYS
FNLNAVRIPPDVDTVTFDWAFGDGNSGSTQVSVGADNTASTTISHAYGQEGAYGLVATLS
GEDGQLADSSAVVTIGEVEERDEELDICNVWRAADQGGQGVTVDNWDISEIPTGAVFDLR
FDAYSIPDKYIVEYPAGAVVHDTGWRGASRYEGDPLYPGGIAGPGRGQADAIFMKGAVDS
FKITVIGPQSGTAWRYDIRCRVLDDGN
Download sequence
Identical sequences Q0A625
187272.Mlg_2372 gi|114321519|ref|YP_743202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]