SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114319707|ref|YP_741390.1| from Alkalilimnicola ehrlichii MLHE-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|114319707|ref|YP_741390.1|
Domain Number - Region: 82-153
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00484
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114319707|ref|YP_741390.1|
Sequence length 167
Comment hypothetical protein Mlg_0546 [Alkalilimnicola ehrlichii MLHE-1]
Sequence
MTEHFDPWVIWLVAGLALILADLLLAGGTSGVLLLLGLTALAGMAAALLGLGLTGQLAVA
GVAGLLLLPVVLWFMRRMSGGRSGTARRDTRVGGETYVVERWGERLGIRVLGDFFPVRLV
DPGDGPAGDRPLAPGERVRVLRFSGITAEVCRVADADRSDPADARRD
Download sequence
Identical sequences Q0AB87
WP_011628295.1.71132 gi|114319707|ref|YP_741390.1| 187272.Mlg_0546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]