SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126695636|ref|YP_001090522.1| from Prochlorococcus marinus str. MIT 9301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126695636|ref|YP_001090522.1|
Domain Number 1 Region: 193-328
Classification Level Classification E-value
Superfamily CBS-domain pair 6.06e-19
Family CBS-domain pair 0.0014
Further Details:      
 
Domain Number 2 Region: 348-420
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6e-17
Family CorC/HlyC domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126695636|ref|YP_001090522.1|
Sequence length 422
Comment hemolysin-like protein [Prochlorococcus marinus str. MIT 9301]
Sequence
MKITLLLFLLFLPAFFAASELSFLLIRPSKVLRLIEEKKKGAFSILKIQKRFRSSLIASQ
FGVTISLIAIGWLSNNLANDYWKSNILSNRFYDLLLFLFVVLVVTLVSGLIPKALVINNP
ESAALRLTTIFDAVRKAMNPIVKIIEFFASACLGLFNLNNKWDSLNSGLSAGELETLIET
DNVTGLKPDEKNILEGVFALKDTQVKEVMIPRSEMVTLPKNITFSELMKQVDKTRHARFF
VIGESLDDVLGVLDLRYLAKPISKGEMEADTLLEPFLLPVTKIIETCSLAEIFPIVRDYN
PFLLVVDEHGGTEGLITAADLNGEIVGEEMLNNRIYSDMRMLDNFSKKWSIAGKSEIVEI
NKKIGCSIPEGTDYHTLAGFMLEKFQMVPKIGDVLDFNNIKFEVISMSGPKIDRVKIILP
KS
Download sequence
Identical sequences A3PAZ6
WP_011862314.1.29415 167546.P9301_02981 gi|126695636|ref|YP_001090522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]