SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159896859|ref|YP_001543106.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159896859|ref|YP_001543106.1|
Domain Number 1 Region: 107-352
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-57
Family Nitrogenase iron protein-like 0.0021
Further Details:      
 
Domain Number 2 Region: 10-89
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 1.34e-21
Family PaaD-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159896859|ref|YP_001543106.1|
Sequence length 359
Comment hypothetical protein Haur_0326 [Herpetosiphon aurantiacus DSM 785]
Sequence
MGLFGKRADAPTQEAVLAALATVQEPELGGNLVARKMIKELNIDGGRVVVLIDLTTPACP
FKEQLANDVRAALAQVPGVSEIEVDFTATVRSYNGIPDKARVPGVSHILAVASGKGGVGK
STVAVNLAVALAQEGANVGLLDADIYGPSAPLMTGARGKPGITQNQKIAPLEAHGIKIIS
VGYFVDDSQPLVWRGPMISSMLRQFLFEVDWGQLDYLIVDLPPGTGDIQLTLAQSIPLSG
SVVVTTPQDVALADAIKGVEMFRKLNVPILGIVENMSYFIAPDTGKRYDIFGHGGARTAS
SKLGVPFLGEIPLGMPIREGGDTGQPAVTQSAKDAYADSFRDVARTLAGRISIETMVAA
Download sequence
Identical sequences A9B7K5
gi|159896859|ref|YP_001543106.1| 316274.Haur_0326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]