SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159898269|ref|YP_001544516.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159898269|ref|YP_001544516.1|
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.34e-17
Family Siroheme synthase N-terminal domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 115-174
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.0000000000235
Family Siroheme synthase middle domains-like 0.0035
Further Details:      
 
Weak hits

Sequence:  gi|159898269|ref|YP_001544516.1|
Domain Number - Region: 170-195
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0288
Family Eferin C-derminal domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159898269|ref|YP_001544516.1|
Sequence length 198
Comment siroheme synthase [Herpetosiphon aurantiacus DSM 785]
Sequence
MYPIVLTNLAQQRCVVVGGGAVAERKVAGLITGGANPIVISPQLTPQLQHWQASNQIQHL
AREYQFGDCEAAFLVVAATNQRLVNQQIAHECHNRPILLNIADAAEEGNFITTANHRQGS
LLFSVSSSGASPALSRYLRQQLSNYFDQRYATLAQIVAAQRAELATLTTTEREQYFDQLL
VELAQQPPTLNHLPTEDL
Download sequence
Identical sequences A9B6S9
gi|159898269|ref|YP_001544516.1| 316274.Haur_1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]