SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159900219|ref|YP_001546466.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159900219|ref|YP_001546466.1|
Domain Number 1 Region: 14-207
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.000000000602
Family ArgJ-like 0.011
Further Details:      
 
Weak hits

Sequence:  gi|159900219|ref|YP_001546466.1|
Domain Number - Region: 190-253
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0458
Family Aspartate receptor, ligand-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159900219|ref|YP_001546466.1|
Sequence length 257
Comment arginine biosynthesis bifunctional protein ArgJ [Herpetosiphon aurantiacus DSM 785]
Sequence
MAYRLLNEGSITTPTGFRVTGIHCGLKTTSRDRDLGLLITKTGCTVTGHFGATSGITGAW
TTANLRRNAEDVRAVLLLTGVDGGRGASAVHNCQELAGLLAEEAWIKPEQVVLLAAGAAG
PFDMDLLRRGVPRALDELDSKGGRRLALALAQEPNPTAQAAVEVEASDGTSASIGGLASS
GDAPRWLITTNAQLSTRLLNRAVLALLEAYPALDQAAILILANPSASLAPTHSNQAAYRE
WYAGLAGLIAHLSEQLA
Download sequence
Identical sequences A9B755
316274.Haur_3702 gi|159900219|ref|YP_001546466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]