SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159900526|ref|YP_001546773.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159900526|ref|YP_001546773.1|
Domain Number 1 Region: 330-562
Classification Level Classification E-value
Superfamily PHP domain-like 1.7e-42
Family PHP domain 0.0032
Further Details:      
 
Domain Number 2 Region: 160-307
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.7e-19
Family DNA polymerase beta-like 0.029
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000000017
Family DNA polymerase beta, N-terminal domain-like 0.0045
Further Details:      
 
Domain Number 4 Region: 58-147
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000811
Family Achaeal helicase C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159900526|ref|YP_001546773.1|
Sequence length 578
Comment phosphotransferase domain-containing protein [Herpetosiphon aurantiacus DSM 785]
Sequence
MLSNQAIAQVFADIADALEVIGENRFRLAAYRRASDTLAAQTTSLASLREQGLLTSLPNI
GEASAAIIGELLDHGHSALADQLLEKVPPGLLQILRVPEIGPKTAARLFRDEGIQDLEAL
FAAAQDGRLAKIKGFGAKSAAKVLSALEAMQNQVLRLRLVDALPVAQALSATLAEIASIS
AVQVVGSTRRYQASVGDLNFVVASLDQAAAYAAIAELPQVAQATPSDNGLRLLLHNGMNA
WIVAVAPEHWGSALVYWTGSTSHVAGLNQLAQAQNWQLDPLNFPDFADEAAVYAALGLEW
IAPELREGWGEIALAQAQQLPKLLEQSAIISDVHWHTTWSDGSASLREMALAGIAKGYRY
MAVADHSAYLGVTGGLDGERLLAQRAEINALNQQLAAEGHEFRLLQSCEVDILPDGSLAL
PDEVLATLDLVVASPHVALRQPRAESTARMLRAINHPLVTIIGHPTGRILNGRAGADYDM
AQIIAAAAATGTVLEVNAGPERLDLDAPNVRAALAAGCNISINTDAHATAGFDNLFYGVV
TARRGGASNQQVINTWDAEAVLALRQQKLQKLGLSSES
Download sequence
Identical sequences A9AVP5
gi|159900526|ref|YP_001546773.1| 316274.Haur_4013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]