SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159901282|ref|YP_001547529.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|159901282|ref|YP_001547529.1|
Domain Number - Region: 138-214
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00115
Family MJ1460-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159901282|ref|YP_001547529.1|
Sequence length 217
Comment hypothetical protein Haur_4770 [Herpetosiphon aurantiacus DSM 785]
Sequence
MAKIQFRKCCKNAYNGNVQALTPIATERHPMYRFERHAPFDLTVYADPGQDRSGPPLTQG
GIFLLISTTASEHCSPEMLDVLDEIDPEAWYHGQLLETMLNSFEDQDPALVVDVGKNIYY
SMETQFRAVGIQKPEDVITTIPMMWVYATRGDGGEWRTRMTGDKTAIIEMEQPYNCMFEQ
GAMQGALECFDARDVQMNHSKCIRNGDAFCELHVSWK
Download sequence
Identical sequences A9B251
gi|159901282|ref|YP_001547529.1| 316274.Haur_4770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]