SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157363804|ref|YP_001470571.1| from Thermotoga lettingae TMO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157363804|ref|YP_001470571.1|
Domain Number 1 Region: 275-302,335-590
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.44e-49
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 1-165
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.82e-32
Family H-NOX domain 0.0000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157363804|ref|YP_001470571.1|
Sequence length 605
Comment methyl-accepting chemotaxis sensory transducer [Thermotoga lettingae TMO]
Sequence
MKGFVVNMWFETWGKLYGKEVVEKLKTQFGLKPDHTYSPLDDVPDELPINVSRKLATLKN
LSFDEIWYRTGRENLYTFFEHYPEFFKKPSFLSFMAAMDAVHRVLTKRIKGATPPRIFFR
LINGNRAIIKYESKRDFRKYFLGLMESASEFFKDPIKYSVVSESRDKVIHIEVDVTATRS
YGRFEKLAVIPVLGLGLFKSIFPTYAFMIPLYAFVLSYLSYTFLPANALIKSMAVGLGTF
VLSIIGMIDFKKGHQSLEQTIESVSEKNLDNPLSVDGVKEFSRLSQSLMNASDSLKEVFL
SISGDVQEMSSYSQKVVDAVNSMKEQLDTMGSLSNEIANTAVQISNDTEKISSAVNSNVD
TITSIIDEQTKIVQSLNDAVSLIANSARNVEGSAEGIVRMSERFSKLVDEGKKLQDQASL
IMEVAETVSTIAEQTNLLALNAAIEAARSGEAGRGFAVVADEIRKLAEESRSSAAKISEF
LSSITAGIEQLGRIIQSEFNEMKQQSQKLIESSEHNKQSSDVISNISSKLNNLIETLHAE
AKNLQSMTGNIQSLLAISEESSATAEEISSSIQNFFMQLKVVLDSVNETMKLLKVVEENF
KDIKF
Download sequence
Identical sequences A8F5S3
WP_012002988.1.90183 416591.Tlet_0941 gi|157363804|ref|YP_001470571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]