SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157364215|ref|YP_001470982.1| from Thermotoga lettingae TMO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157364215|ref|YP_001470982.1|
Domain Number 1 Region: 4-311
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-75
Family Methylenetetrahydrofolate reductase 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157364215|ref|YP_001470982.1|
Sequence length 315
Comment methylenetetrahydrofolate reductase [Thermotoga lettingae TMO]
Sequence
MVFMKVIDCVKKGQILSIEILPPNRGQNIEEIYAVLDELMNFPISFINVTKHAPEMTYLE
LEDGIVKVPKVKRPGTVGMTAALMNRYNIDVVPHVLCFGMNKYQIEDMLIDLHLIGVRNL
FVIRGEYENQTIEEKDSYSHASDLVKQISNMNMGEYLYPCENAKPTDFCIGVAGYPEKHF
EAPNIEEDMRYLKKKIESGADYVITQMIFDFDVYKKFVERARQLSINVPIIPGVKPVVSL
KSIYTIPRKFFVNIPESFVKQMQEAKTHREEFQIGTKYMAKLVEKLLSSGAPGVHVFTMG
KGQSTKALLEAVFNR
Download sequence
Identical sequences A8F6Y4
gi|157364215|ref|YP_001470982.1| 416591.Tlet_1361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]