SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157148659|ref|YP_001455978.1| from Citrobacter koseri ATCC BAA-895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157148659|ref|YP_001455978.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.46e-109
Family FMN-linked oxidoreductases 0.0000000000239
Further Details:      
 
Domain Number 2 Region: 333-517
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.41e-39
Family N-terminal domain of adrenodoxin reductase-like 0.000000657
Further Details:      
 
Domain Number 3 Region: 468-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-26
Family C-terminal domain of adrenodoxin reductase-like 0.00000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157148659|ref|YP_001455978.1|
Sequence length 672
Comment hypothetical protein CKO_04487 [Citrobacter koseri ATCC BAA-895]
Sequence
MSYPSLFAPLDLGFTRLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVTGGI
APALSGVGMEGGATLNDASQLPHHRVITDAVHEEGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFTPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTVRTNQR
DDEWGGDYARRMRFAVEVVRAVRQRVGSDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVTVPLVTTNRINDPQVADDIL
ARGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPIVPAEHKKSLAVVGAGPAGLAFAINAAARGHDVTLFDALAEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNRFVTADDLQPFDEAILACGIEPRKPSIEGIDHPK
VLTYLEVLRDKTPVGKRVAIIGCGGIGFDTAMYLSQPGDPSSLSIAEFCVEWGIDTSLQQ
PGGLRPEGPHLSRSPRQIVMLQRKASKPGQGLGKTTGWVHRATLLSRGVKMIPAVSYQKI
DDDGLHVLINGEPQLLNVDHVVICAGQEPRRELAEPLRASGKTVHLIGGCDVAMELDARR
AIAQGTKLALAI
Download sequence
Identical sequences A8APX9
WP_012135224.1.88595 290338.CKO_04487 gi|157148659|ref|YP_001455978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]