SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157147666|ref|YP_001454985.1| from Citrobacter koseri ATCC BAA-895

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157147666|ref|YP_001454985.1|
Domain Number 1 Region: 180-395
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.31e-74
Family Type II restriction endonuclease catalytic domain 0.0000000554
Further Details:      
 
Domain Number 2 Region: 4-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-59
Family Type II restriction endonuclease effector domain 0.000000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157147666|ref|YP_001454985.1|
Sequence length 400
Comment hypothetical protein CKO_03469 [Citrobacter koseri ATCC BAA-895]
Sequence
MMSGLHSWLLDKSTSDTYMFIKRLSANDTGATGGHQVGIYIPSGIVEHLFPSINHTRDLN
PSVMLNAHTSSHNCPDSEARAIYYNGRFFGKTRNEKRITRWGGGKNPLQDPENTGALALL
AFDHHQGSDSQFVDIWVCHNAEEEDIVESSLGEIVPGSLVYGPANEILGGLALKEPVSSG
YRLPEEWRTNFPSGKEIIQYAAAHYSPNVIGPDKQLIERRRVEYEIFLLVEEMHVLGIVQ
SGFGSVNEFIALANSVSNRRKSRAGKSLELHLEQLFNEHGLKTFETQAVTEGNKKPDFLF
PSAQAYHDEAFPEQKLRMLAVKTTCKDRWRQILNEADRIQDIYLFTLQEGVSVAQFQEMQ
QERVRLVVPSSLHDKYPKAIREYLISLETFIDETKSLYVD
Download sequence
Identical sequences A8AM36
gi|157147666|ref|YP_001454985.1| 290338.CKO_03469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]