SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163855242|ref|YP_001629540.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163855242|ref|YP_001629540.1|
Domain Number 1 Region: 140-276
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.09e-17
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.034
Further Details:      
 
Domain Number 2 Region: 66-112
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000372
Family AraC type transcriptional activator 0.009
Further Details:      
 
Weak hits

Sequence:  gi|163855242|ref|YP_001629540.1|
Domain Number - Region: 22-61
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00103
Family AraC type transcriptional activator 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163855242|ref|YP_001629540.1|
Sequence length 291
Comment AraC family transcriptional regulator [Bordetella petrii DSM 12804]
Sequence
MDPRIQYCITQIEQKILHESTEHCVHDALIQELAHEIRLSRFHLTRLFLKDFQHSPRDYI
HRNLMGRCALMVAHTRQPLFSIAIDMGFSSQQAFTRAFTRYWGISPCRFRLAHARYIAKM
NESGMVAADPHCPPGNQVRVTVRELPPTRFWAVRYEGMSSQKYACWNDFRRLFAHLRSDL
LTGPFFGLTYDTPMFVPTPFMRYYCGVQVPPGFGPKPKDAFEITLPGGRIAMCEAHCTAD
GLPALYANLLDQWLPRSGYSLRASCFAERFETFPTNWEFNPRRVQLNCWIQ
Download sequence
Identical sequences A9I8N6
gi|163855242|ref|YP_001629540.1| 340100.Bpet0937 WP_012247949.1.34756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]