SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163856238|ref|YP_001630536.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163856238|ref|YP_001630536.1|
Domain Number 1 Region: 96-244
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-33
Family Reductases 0.017
Further Details:      
 
Domain Number 2 Region: 237-357
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.23e-28
Family 2Fe-2S ferredoxin-related 0.0078
Further Details:      
 
Domain Number 3 Region: 5-107
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.22e-28
Family Ferredoxin reductase FAD-binding domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163856238|ref|YP_001630536.1|
Sequence length 362
Comment phenylacetic acid degradation NADH oxidoreductase [Bordetella petrii DSM 12804]
Sequence
MSQTSFHSLKVASVARNTRDAVVVTFDLPADLRAQFAFRPGQYLTLRTELGGEELRRSYS
ICSAPGDGVLRVAIKKVDEGVFSNWANHELQPGQTLEVMPPAGNFTVDFAPEHRRHYVAF
AVGSGITPVFSLVKTALSTEPHSRFTLFFGNRASSSVLFREEIEDLKNLYMERFSLVYIM
SRESQDIELFNGRLDGDKVDQLLSAWMRPDDIDYAFVCGPQTMIESVVQHLQARGIPKSQ
IKFELFGAPRGPRALRTGRDAPAAPGKGQCEVTVVQDGHRRTFIIDKNKDSVLDSALAQG
VELPYSCKGGVCSTCRCKVIEGEVDMDANFALEDYEVARGFVLSCQSFPVSDRLVLDFDQ
ET
Download sequence
Identical sequences A9IJQ5
gi|163856238|ref|YP_001630536.1| WP_012248848.1.34756 340100.Bpet1928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]