SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163856417|ref|YP_001630715.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163856417|ref|YP_001630715.1|
Domain Number 1 Region: 158-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.15e-70
Family Methylesterase CheB, C-terminal domain 0.000000169
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily CheY-like 6.97e-29
Family CheY-related 0.00000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163856417|ref|YP_001630715.1|
Sequence length 352
Comment chemotaxis-specific methylesterase [Bordetella petrii DSM 12804]
Sequence
MMKKIRVLCVDDSALVRGLMTEIINSHDDMEVVAVAPDPLVARELIKQHNPDVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTERGGETTLRALELGAIDFVTKPKLGIRHGMLEY
SELIADKIRAAARARLRVPAASAQAAPPARLRSPFASSEKLVIVGASTGGTEAIREVLRP
LPPDSPAVLITQHMPAGFTRSFAQRLDALCAVTVREATHGERVLPGHVYLAPGGDTHMKL
GRSGANYVIELEASEPVNRHRPSVDVLFHSAASAAGANAIGVILTGMGKDGAAGMLAMRQ
AGAHTLAQDEASCVVFGMPREAIALGAAAEVVALDAMSERILTRLGDRANRV
Download sequence
Identical sequences A9IKN2
340100.Bpet2106 gi|163856417|ref|YP_001630715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]