SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163857504|ref|YP_001631801.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163857504|ref|YP_001631801.1|
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.08e-49
Family DJ-1/PfpI 0.0054
Further Details:      
 
Domain Number 2 Region: 269-316
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000179
Family AraC type transcriptional activator 0.025
Further Details:      
 
Domain Number 3 Region: 322-372
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000202
Family AraC type transcriptional activator 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163857504|ref|YP_001631801.1|
Sequence length 378
Comment AraC family transcriptional regulator [Bordetella petrii DSM 12804]
Sequence
MEMAAMYRPWQMARTRALRRPACRRARAVMETGAEVDRPHCSERCYGMNDVFPLKIAMPI
QIAFVMTPGFQLLDMAGPLSVFQVAAEVAAGPRGPAYAPLLVSARGGRVASSAGVEVLTR
PWRDVRPDIVLVPGGTGPRQTGATPGARAFLMDAQARRARLASVCTGAFVLAAAGLLDGR
RATTHWRHAAELQRRYPDIKVDSDRIYLRDEHVWTSAGITAGIDLALAMVEEDLGADVAR
QVARDMVVYHRRAGGQSQFSALQDLAPQSERMRRVLGYIRQHLTAPLSIEELATAACLSP
RQFIRSFKAETGQTPAKAVERIRAEAARAHVEAGGMSIDAIARVTGFADAERMRRAFVRR
YGQPPQALRRAAREALLA
Download sequence
Identical sequences A9IUE6
340100.Bpet3191 WP_012250094.1.34756 gi|163857504|ref|YP_001631801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]