SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163858452|ref|YP_001632750.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163858452|ref|YP_001632750.1|
Domain Number 1 Region: 5-196
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 8.15e-51
Family DJ-1/PfpI 0.004
Further Details:      
 
Domain Number 2 Region: 270-321
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000143
Family AraC type transcriptional activator 0.027
Further Details:      
 
Domain Number 3 Region: 219-267
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000636
Family AraC type transcriptional activator 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163858452|ref|YP_001632750.1|
Sequence length 327
Comment AraC family transcriptional regulator [Bordetella petrii DSM 12804]
Sequence
MMPSRTVALAIHDGVQALDVAGPVDVFHEANGYLPPQDRYETVLVAADRGPFRASNRMQI
LADLSFEEAGAAFDILLVAGGPALPDAKPDARFVAWLRAATQRAGIYGAICTGAFILGHA
GLLDHRRVTTHWQNASTLAARFPRAQVEPDAIYVRDDRLVTSAGVTAGIDLALALVSQHH
GTEIAVAVAKRLVVVAQRQGGQSQFSPYLTAPADPVSPVARIQAHVMTHIGQRHTLESLA
AEVGMSPRNLARYFVQEAGMTPHEFVQRARIDAARMMLEASERPLKTVAYECGFGTVDRM
RIVFSERLGVTPAQYRASFRQRSVQGR
Download sequence
Identical sequences A9I9M4
340100.Bpet4134 WP_012251023.1.34756 gi|163858452|ref|YP_001632750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]