SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163858509|ref|YP_001632807.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163858509|ref|YP_001632807.1|
Domain Number 1 Region: 21-93
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000128
Family Tetracyclin repressor-like, N-terminal domain 0.0059
Further Details:      
 
Domain Number 2 Region: 102-204
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000745
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163858509|ref|YP_001632807.1|
Sequence length 240
Comment TetR family transcriptional regulator [Bordetella petrii DSM 12804]
Sequence
MMAIDSHERDAMHSLGARAMKKRGRQPDPAKAQVILEAACSSFSHRGYFGTSMETIAACA
HTTKATIYAKFDSKERLFAAALEELERRMPRPQDIMRCSGKDVLDDLLVIASRLLKLALH
RSTLGIYRMLLLPIDHAPRLGAQFWQKIVEPYRKAMEEVLRDAHRCQSLHIIDPRLASDH
FFSLVIGDPTLRCLPNAHRPMSVEARTRHVRAAVKCFVAHYRVPLAQQDEWNRLPLSPLP
Download sequence
Identical sequences A9IA35
340100.Bpet4191 gi|163858509|ref|YP_001632807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]