SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163854323|ref|YP_001628621.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163854323|ref|YP_001628621.1|
Domain Number 1 Region: 126-275
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.53e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0091
Further Details:      
 
Domain Number 2 Region: 63-111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000627
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000224
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163854323|ref|YP_001628621.1|
Sequence length 276
Comment AraC family transcriptional regulator [Bordetella petrii DSM 12804]
Sequence
MKATTRIHYANRLEPVLHWLASHPDAAPDLYHLADLACLSPYHFHRVYRALMGETVNATM
QRMRMHRASVDLAGSRPMPQVARRAGYTSQAAFNRAFGAAFGMPPGRYRHARSRPFNPQE
LGMYPVTIEQFAGASLATLAHQGDYQNIGATFDRLFMLAAGRDLVGPATRSFGVYYDDPA
QVPADRLRSRAGLTLPDGASADPVFEPFALPAARCAVLEYTGPYSEIEAAYNWLFAQWLP
ASGHETLDFPMWEEYVNDPKTTPAAELKTRIYLPLA
Download sequence
Identical sequences A9HVI2
gi|163854323|ref|YP_001628621.1| WP_012247048.1.34756 340100.Bpet0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]