SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163854704|ref|YP_001629002.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163854704|ref|YP_001629002.1|
Domain Number 1 Region: 109-237
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.66e-25
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00092
Further Details:      
 
Domain Number 2 Region: 23-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.07e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163854704|ref|YP_001629002.1|
Sequence length 265
Comment fumarate reductase iron-sulfur protein [Bordetella petrii DSM 12804]
Sequence
MPRQDPTSGVLQVSVWRGGADGGFQVFEVPRRDNQTVLDVATHIQRHLDSTLSYRYACRV
GMCGSCAMTVNGVARWTCRTHVSRVARNGRIELAPLSNLPIVKDLVTDMAPFFDKWQRAQ
GRYTGPAGRHDPVARVDPSSPRRRAADAGIECIGCGVCYASCDVVSWKPQFLGPAALNRA
WTLVNDERDTGGARRLAAVAGDAGCHSCHTQGSCTVRCPKGIAPTAAIAGLKRMAARAAL
RGELPEADEAEGPAAHADGLTGVAP
Download sequence
Identical sequences A9HYE8
WP_012247422.1.34756 340100.Bpet0399 gi|163854704|ref|YP_001629002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]