SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163857630|ref|YP_001631928.1| from Bordetella petrii DSM 12804

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163857630|ref|YP_001631928.1|
Domain Number 1 Region: 458-565
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163857630|ref|YP_001631928.1|
Sequence length 611
Comment sulfate permease [Bordetella petrii DSM 12804]
Sequence
MGAARRVSKLASRLFGTWVDDIGPATLRADALAGLLGALLVLPQGVAFATLAGLPPEYGL
YSAIVPCVVAALFGSSRHVMSGPTNANSLALYAVLAPLAAAGSSAYIQLALAVTILVGIL
QWLVGTLRLGSLANFISPSALFGFTSGAALLIAVHALKDALGLDGIHAHAAGAVLLGVAR
GLGSLHWGALLVAAATIAASALARRWDRRKPYMLIGLAVGTALAAGLNAWVFEAAGRPIS
VLGALAQPWPPFHVPDIEWGKLPDLLGLAFALSIVALAQSISIAKAVAARSGQIIDANRE
FIGQGLSNIVGGFFSSYLSCGSLNRSIPNFESGARTPMAAVFAAVLLVALVMASAPLLAL
IPHAAIAGLLMLVAWNLLELPRWRHVARVQRSECMIALATLVATVTIRMEIAILLGTLLS
LLAYLHRTSRPAMRTMGFDAHDPDRHFAVLEGRPDALPECPQLKLLRMEGSVYFGAVAHV
ADRLQTLRAAPDAPRHLLIMAKSMNFIDHAGALLWEDELRKRREAGGDLYFHRPRPEVVQ
MWRRLGFIERLGEDHIFPDKHTAIADIYMRLDPDVCAGCTARIFRECGPLGHAGQRACGN
QAPASTGSLPR
Download sequence
Identical sequences A9HWV4
340100.Bpet3318 WP_012250217.1.34756 gi|163857630|ref|YP_001631928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]