SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|160878569|ref|YP_001557537.1| from Clostridium phytofermentans ISDg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160878569|ref|YP_001557537.1|
Domain Number 1 Region: 4-68
Classification Level Classification E-value
Superfamily L28p-like 3.14e-21
Family Ribosomal protein L31p 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160878569|ref|YP_001557537.1|
Sequence length 70
Comment 50S ribosomal protein L31 [Clostridium phytofermentans ISDg]
Sequence
MKIMQEAIQPKYYQAKVTCNCGNEFVTGSTKPEIHVEVCSKCHSFYTGQQKAAAARGAID
KFNRKYGLNN
Download sequence
Identical sequences A9KHD1
gi|160878569|ref|YP_001557537.1| 357809.Cphy_0411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]