SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160880823|ref|YP_001559791.1| from Clostridium phytofermentans ISDg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160880823|ref|YP_001559791.1|
Domain Number 1 Region: 180-368
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.94e-57
Family Methylesterase CheB, C-terminal domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily CheY-like 2.13e-25
Family CheY-related 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160880823|ref|YP_001559791.1|
Sequence length 372
Comment response regulator receiver modulated CheB methylesterase [Clostridium phytofermentans ISDg]
Sequence
MIKNILVIDDSALMRRLISDIIRSDKRFSISDVATNGLEGFDLITLNPTKYDAILLDINM
PKMNGIQLLEQLNKMRLKLKIIMVSTLAKEGAKETIRCLELGAFDFVTKPESYIEAKDGA
FKEKILTALTFATELVPPTEFKVADKTRTVLTTLNTQTHDRITKPKAFIERKSHVRVLNS
AKKIVALACSTGGPKALHQVIPKLPANLDAPIVIVQHMPEGFTNSLASRLNELCALTVKE
AEHGELIQKGYVYVAKGGSQLRIVKSRDGYTLSVTTEAARNGLKPCADIMYESLVDTDYE
DITCVILTGMGGDGTQGIKKLTEKNNIYVIAQDEATSTVYGMPKVIYESGLVDEVVPLEM
VADAITKNVGVQ
Download sequence
Identical sequences A9KND5
gi|160880823|ref|YP_001559791.1| WP_012200704.1.8979 357809.Cphy_2691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]