SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160881022|ref|YP_001559990.1| from Clostridium phytofermentans ISDg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160881022|ref|YP_001559990.1|
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 3.14e-16
Family Ribosomal protein L28 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160881022|ref|YP_001559990.1|
Sequence length 65
Comment 50S ribosomal protein L28 [Clostridium phytofermentans ISDg]
Sequence
MAKCAICDKGAHFGKVVSHSRSQVSGRSNKMWKSNVKSVRIKVNGGTQKMYVCTSCLRDG
KVERA
Download sequence
Identical sequences A9KPH7
WP_012200902.1.8979 gi|160881022|ref|YP_001559990.1| 357809.Cphy_2893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]