SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160881791|ref|YP_001560759.1| from Clostridium phytofermentans ISDg

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|160881791|ref|YP_001560759.1|
Domain Number - Region: 28-57
Classification Level Classification E-value
Superfamily Trm112p-like 0.00114
Family Trm112p-like 0.0085
Further Details:      
 
Domain Number - Region: 109-143
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0199
Family RBP12 subunit of RNA polymerase II 0.042
Further Details:      
 
Domain Number - Region: 164-232
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.0628
Family Methylenetetrahydrofolate reductase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|160881791|ref|YP_001560759.1|
Sequence length 398
Comment hypothetical protein Cphy_3673 [Clostridium phytofermentans ISDg]
Sequence
MHTIFSAGIRHVIILYRKRELLMVIQYKCPSCGADLTFDTTSKKLHCASCGSYYSIDSMP
PPDIPLGESDDAPKVNPFGPQDIYEEASFDYKQKSEWQHKDFSSSKVSEYHCKNCGAVVI
TDKDTIATSCSFCGAAVVLSDRIEGQLEPSRIIPFKINRDQATKAFQKWCKKGLLTPTEF
KHADRVKNITGIYIPFWLYDLNGIGDIDATCTKVRTYTRGDYIYTETQYYHVYRKVNLNY
SNVPADASEKMNDNLMDRLEPYQNHDLITFEMPYLAGYLAEKYNFNADQIFPRARDKVGG
FVDNYLRNTIHGYHSVITNRKDISIYKKNAYYTLLPVWMVCYDYKDSEHIFAMNGQTGKI
VGKPPLSVPKMFAWFALIASLSFLIIKLLVVLNGGPWL
Download sequence
Identical sequences A9KJK0
gi|160881791|ref|YP_001560759.1| 357809.Cphy_3673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]