SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162449517|ref|YP_001611884.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162449517|ref|YP_001611884.1|
Domain Number 1 Region: 249-492
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.57e-18
Family alpha-L-arabinanase-like 0.082
Further Details:      
 
Domain Number 2 Region: 43-95
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000138
Family TNF receptor-like 0.007
Further Details:      
 
Domain Number 3 Region: 198-267
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.00000392
Family Glycosyl hydrolases family 32 N-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|162449517|ref|YP_001611884.1|
Domain Number - Region: 42-200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162449517|ref|YP_001611884.1|
Sequence length 518
Comment hypothetical protein sce1247 [Sorangium cellulosum So ce56]
Sequence
MARSGSRSRARFLVALLWTSGCSDPVTTTGGDAGPGAEPPACSEGTWDHDGDSATSCVPW
TGCTAGTFASAEGSPTADRRCTACPEDTFSDTMNAPSCKTHTPCAPGTRQTAPGTSSTPA
QCDGCSPGTYCAGGTAAPVDCADGTWDDDANPATTCVAWTDCVPGEHVGTEGSSTTNRSC
VECTNGEHTATMNATSCSPGAWVLSYFGPHQDVASDSLHLAYSTDGLRWSTLAGGQPAYQ
LTGMGTNHIRDPFLFRKNDGTYIYIATDWTLSENDANYWNNPSSKIFVADSTDLITFKNP
RLITLTNLPGPRDTPMHAWAPEAYYDPDRKLYAIIWSGNDTTGANRIYVSYTEDFVTIVN
PTPDVLFDPGYSVIDATITQWNDRNYLFFKDETDSSGSALTGSGKDIQIARSPTLALDPG
TFTRWSPDYITRGSTQSSRRATEGPFVIKDPRQSRWYLFADYYLNGGVFGCWSTTDLDAD
PGSWTELPSTQYRFPSGVRHANAVRVTQAELDAIIAHY
Download sequence
Identical sequences A9F662
gi|162449517|ref|YP_001611884.1| WP_012233881.1.90317 448385.sce1247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]