SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162450886|ref|YP_001613253.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162450886|ref|YP_001613253.1|
Domain Number 1 Region: 588-706
Classification Level Classification E-value
Superfamily Cytochrome c 1.92e-20
Family Di-heme cytochrome c peroxidase 0.01
Further Details:      
 
Domain Number 2 Region: 51-313,341-434
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 5.23e-20
Family Nitrous oxide reductase, N-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 440-554
Classification Level Classification E-value
Superfamily Cytochrome c 0.000000229
Family Di-heme cytochrome c peroxidase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162450886|ref|YP_001613253.1|
Sequence length 706
Comment hypothetical protein sce2614 [Sorangium cellulosum So ce56]
Sequence
MPRNTNARRRRWHGRPMKHRSSTLLLAALLAAACSRPSRDTPAVERSAEVAGTAAPAPPA
SPPPPRLQAVTRVGSALARAPQDDALYLADEDHAVLRRIPLPVDVSTPPVEIAMPGRPAQ
VLALADRVLVTIRDPGLLLILRPDPAAGLVEAARVPLPADAWGLAITPDERTALVTSAWA
GKVSAVDLATATATWAIDVPREPRGVVIREDGAAAYVTHLTSASLTRIALGGAPEARPVA
LPPSPFRAPHGKSLSASLGYAAALSPDGRRLFVARHALGALGEQAWFGASTVDVLMTSDE
APLAPRRRQGAPLWRASALDGAAFDDEELELPNTSLAPFVQPRALVYRKSTRTLLVASEG
TDTLVELDALAVDPALRPLRTYDLGRHAGPDVYVATLCGAPSGVALSADESMAWVVCRST
DALAIVRLDEHRDDAPFEASPVPYIALAGAPVPQQAALGRKLFYNAVDWGTSGGLGCAGC
HPDGRDDGHVWHEARVMDIGGESVNFLGSAENQPADVEPRGGVPRQTPMLAGRVSAEGPY
GWNAQSENLAERLREGFGLHRWGPGGLGNGELALRARHLAAFLRVGLAPPPREARKLTPQ
EEHGRALFMSDTAQCARCHVPETEHTDRMGYPMPGFAVRPGFADEKAGQVFKTPSLRFVG
GTAPYYHDGSAKTLEELIDENQDRMGRTSHMSRNDKAALAAFLRTL
Download sequence
Identical sequences A9G738
gi|162450886|ref|YP_001613253.1| 448385.sce2614 WP_012235246.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]