SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162453917|ref|YP_001616284.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|162453917|ref|YP_001616284.1|
Domain Number - Region: 344-406,444-495
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.00628
Family Nitrous oxide reductase, N-terminal domain 0.059
Further Details:      
 
Domain Number - Region: 214-327
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.051
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162453917|ref|YP_001616284.1|
Sequence length 557
Comment hypothetical protein sce5641 [Sorangium cellulosum So ce56]
Sequence
MRPEPGAIRSVVSCACLLAAAAGGCNAIIGLEVGELAPSQSGADAASASSSGGPGAGGSG
AGGEGTGGAGGGDGGGGGSGGDGGGGGGSGGNGGGSGGGGSGGGGPLCSDAEGTVVEPSA
SWGETLGFDVGDLAASDGALTAVITEVLASGAFRFSVAKWTSGGENDSRYGLSANDVWGL
HLAAGDGATYVAGEAAGATSLPGGLLDACRVGPALVATSYTTSFVAALDANGRCGWAWSV
DAQHNTTARAMAANSEAVVFAVDVTDAGRSFGPCELKSVPAESALLAALYPADGACKWQQ
RLGPRAAVTVKALPVNPKASGNLVTVVGDYESLGGAVTFGGQTPFASEQRDVFVARYTAI
DGALVDLTTLNVEGDQQVAQHGAALLPGGDVVIAGSYRGVVDFGGGCPALPDAGDTESFF
VARVSRKGVVWSRGFGDDKESQVAAGVAVDGAGAIYVTGEFTGTIPLGSAGSLTTSQKRA
GFLMRLDAQGNLISATKVEGAGTVALRVVAVDGALGGPVYVAGAVTGALHLDGLAAPLGS
ESDNESRGFIARLSGAR
Download sequence
Identical sequences A9G3W2
448385.sce5641 gi|162453917|ref|YP_001616284.1| WP_012238269.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]