SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162457191|ref|YP_001619558.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162457191|ref|YP_001619558.1|
Domain Number 1 Region: 125-446
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.12e-38
Family Nitrous oxide reductase, N-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 607-726
Classification Level Classification E-value
Superfamily Cytochrome c 6.52e-20
Family Di-heme cytochrome c peroxidase 0.0051
Further Details:      
 
Domain Number 3 Region: 37-108
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000209
Family PKD domain 0.0065
Further Details:      
 
Domain Number 4 Region: 467-596
Classification Level Classification E-value
Superfamily Cytochrome c 0.000000000033
Family Di-heme cytochrome c peroxidase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|162457191|ref|YP_001619558.1|
Sequence length 782
Comment hypothetical protein sce8906 [Sorangium cellulosum So ce56]
Sequence
MRSLRRVLGLAFGICWAAAWPAEAHAVTASIPERAPSLAGEPVTFDLTIGDAVGPVQVRW
DMGDETRTEFMVDDVQQVHSYAAPGHYPVLVTVKDDVGFTSVAFVHTVHRPLVTGDAAGS
TDLVYDRPNAKVYTANYENDSVSVVDTNALTKLAEVPVARGPVGVALTAQGKLWVLHRDA
HALSIIDTTSLAVESEVRLPYASQPMGLAISPAGDAAYVTLMAVGKVLKLDAASGAVVAE
LSLGGTPRGVSVSHDGAQIYVTRFLSGDSHGEVARIDAATFQVSTRFELAADTTTEDTDQ
QGRGLPNYLFSVGLSPDGLFAWVPGKKDNIFRGPFRDQLALSDDNTVRPLVALLNVAEGV
EDVARRIDLDDRNLPNQVVFTPLGDYAFVSVAGSALVEVRDTYTGEFVTALKETGFAPRG
LALTETDRLFVHASLSRTVAVYDVADIISSHDLITKKLADIPTVAAEKLDAQVLRGKQLF
FNSEDVRMSDQGYISCASCHFDGADDGRVWDFGSVGEGLRNTVSLLGRRGTGHGNVNWSG
SFDEIQDADDNIRDLFGGKGFLSAEQLAVGTVATPRGDKKAGLSPELDALAAFLGSLDTH
HPSPFRNPDGSLTQDGVAGRAIFKRLGCGFCHTGADGTDSAGGKLHDVGTVKASSGMRAG
EPLLGIDTPTLNGVWETAPYLHDGSAPTLRDVLVTANPEDRHAFTSALSEAELGQLIAYV
QQLDGTVDLEPSEGDGAGEEPSEEGLFGCSVAGGRGDRHAPLLSFALVAGLMTFGARRGR
PA
Download sequence
Identical sequences A9G8W2
448385.sce8906 gi|162457191|ref|YP_001619558.1| WP_012241517.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]